Spike Receptor Binding Domain (RBD) of SARS-CoV-2 Omicron BA.2.12.1 (His tag)
Catalog Number:
K53J91
Description:
A recombinant form of the receptor binding domain (RBD with amino acids 319 to 541) of the spike (S) glycoprotein gene from severe acute respiratory syndrome-related coronavirus 2 (SARS-CoV-2) Omicron BA.2.12.1 strain was produced by insect cells, followed by purification. This product contains C-terminal 6 hexa-histidine tag. Amino acid sequence is rvqptesivrfpnitnlcpfdevfnatrfasvyawnrkrisncvadysvlynfapffafkcygvsptklndlcftnvyadsfvirgnevsqiapgqtgniadynyklpddftgcviawnsnkldskvggnynyqyrlfrksnlkpferdisteiyqagnkpcngvagfncyfplrsygfrptygvghqpyrvvvlsfellhapatvcgpkkstnlvknkcvnftghhhhhh. This product has been run on SDS-PAGE with reduced condition. We also evaluated its binding to ACE2-Fc and two antibodies in ELISAs. RV57 (Cat. No. F5L83) was tested to bind to RBD of Wuhan strain (WT), but not binding to this variant.
Applications:
Crystallization (Crys), ELISA, SDS-PAGE (SDS), Western Blotting (WB), Immunization or Antibody Sorting Probe
Source:
Insect cells
Biosafety Level:
BSL-1
Organism:
SARS-Related Coronavirus 2 (virus caused COVID-19)
Size and Formulation:
100 or 500 μg in PBS, pH7.2, without preservatives.
Note: Not lyophilized formulation, so no lyophilized protectant reagents added.
Endotoxin:
Less than 1.0 EU per μg by the LAL method / rFC method.
Shipping or storage condition
Ship with dry ice. Recommend -80°C storage for long-term. Store at 4°C or −20 °C for short-term. Multiple freeze/Thaw cycles will reduce its activity. Aliquot is recommended.
Note:
For research use only.















