Spike Receptor Binding Domain (RBD) of SARS-CoV-2 Omicron BA.4/5 (His tag)

Price range: $288.00 through $969.00

A recombinant form of the receptor binding domain (RBD with amino acids 319 to 541) of the spike (S) glycoprotein gene from severe acute respiratory syndrome-related coronavirus 2 (SARS-CoV-2), Wuhan-Hu-1 (GenBank: MN908947) bearing mutations identified in Omicron BA.4/5 strain was produced by insect cells, followed by purification.

Spike Receptor Binding Domain (RBD) of SARS-CoV-2 Omicron BA.4/5 (His tag)

Catalog Number:

B90Y94

Description:

A recombinant form of the receptor binding domain (RBD with amino acids 319 to 541) of the spike (S) glycoprotein gene from severe acute respiratory syndrome-related coronavirus 2 (SARS-CoV-2) Omicron BA.4/5 strain was produced by insect cells, followed by purification. This product contains C-terminal 6 hexa-histidine tag. Amino acid sequence is rvqptesivrfpnitnlcpfdevfnatrfasvyawnrkrisncvadysvlynfapffafkcygvsptklndlcftnvyadsfvirgnevsqiapgqtgniadynyklpddftgcviawnsnkldskvggnynyryrlfrksnlkpferdisteiyqagnkpcngvagvncyfplqsygfrptygvghqpyrvvvlsfellhapatvcgpkkstnlvknkcvnftghhhhhh. This product has been run on SDS-PAGE with reduced condition. We also evaluated its binding to ACE2-Fc, anti-His mAb and a negative mAb in ELISAs.

Applications:

Crystallization (Crys), ELISA, SDS-PAGE (SDS), Western Blotting (WB), Immunization or Antibody Sorting Probe and others

Source:

Insect cells

Biosafety Level:

BSL-1

Organism:

SARS-Related Coronavirus 2 (virus caused COVID-19)

Size and Formulation:

100 or 500 μg in PBS, pH7.2, without preservatives.

Note: Not lyophilized formulation, so no lyophilized protectant reagents added.

Endotoxin:

Less than 1.0 EU per μg by the LAL method / rFC method.

Shipping or storage condition

Ship with dry ice. Recommend -80°C storage for long-term. Store at 4°C or −20 °C for short-term.  Multiple freeze/Thaw cycles will reduce its activity. Aliquot is recommended.

Note:

For research use only.

Weight 7 lbs
Dimensions 11 × 11 × 11 in
Size

100 μg, 500 μg

spike receptor binding domain (rbd) of sars cov 2 omicron ba.4/5 (his tag)Spike Receptor Binding Domain (RBD) of SARS-CoV-2 Omicron BA.4/5 (His tag)
Price range: $288.00 through $969.00Select options
Scroll to Top