SARS-CoV-2 nucleocapsid (N) protein – C-terminal domain (His and Myc tags)

Price range: $288.00 through $969.00

A recombinant form of nucleocapsid (N) protein C-terminal domain (CTD) (AA 255-364) from SARS-CoV-2 virus (Wuhan Strain, GenBank: NC_045512.2) was produced by insect cells, followed by purification.

SARS-CoV-2 nucleocapsid (N) protein – C-terminal domain (His and Myc tags)

Catalog Number:

M47G62

Description:

A recombinant form of nucleocapsid (N) protein C-terminal domain (CTD) (AA 255-364) from SARS-CoV-2 virus (Wuhan Strain, GenBank: NC_045512.2) was produced by insect cells, followed by purification. Amino acid sequence is SKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFP. This product contains N-terminal Myc tag and C-terminal 6 hexa-histidine tag. This product has been run on SDS-PAGE with reduced condition. We evaluated the binding of this protein to mAb clone RV20 (NTD-specific, Cat# W89S59), two tag-specific antibodies (anti-His or Myc) and one convalescent serum in ELISAs, see results.

Applications:

Crystallization (Crys), ELISA, SDS-PAGE (SDS), Western Blotting (WB), Immunization or Antibody Sorting Probe, and others

Source:

Insect cells

Biosafety Level:

BSL-1

Organism:

SARS-Related Coronavirus 2 (virus caused COVID-19)

Size and Formulation:

100 or 500 μg in PBS, pH7.2, without preservatives.

Note: Not lyophilized formulation, so no lyophilized protectant reagents added.

Endotoxin:

Less than 1.0 EU per μg by the LAL method / rFC method.

Shipping or storage condition

Ship with dry ice. Recommend -80°C storage for long-term. Store at 4°C or −20 °C for short-term.  Multiple freeze/Thaw cycles will reduce its activity. Aliquot is recommended.

Note:

For research use only.

Weight 7 lbs
Dimensions 11 × 11 × 11 in
Size

100 μg, 500 μg

sars cov 2 nucleocapsid (n) protein – c terminal domain (his and myc tags)SARS-CoV-2 nucleocapsid (N) protein – C-terminal domain (His and Myc tags)
Price range: $288.00 through $969.00Select options
Scroll to Top