Monkeypox Virus Dimeric A35R protein (2022 Strain, Myc and His tags)
Catalog Number:
S95L46
Description:
Monkeypox virus (MPXV) is a member of the Orthopoxvirus of the family Poxviridae. A35R extracellular enveloped virus (EEV) envelope glycoprotein is needed for formation of actin-containing microvilli and cell-to-cell spread of virion EEV membrane phosphoglycoprotein, similar to Vaccinia virus strain Copenhagen A33R. A33 contains a membrane-proximal cysteine on ectodomain that forms an intermolecular disulfide bridge.
A recombinant form of monkeypox virus protein A35R (Genbank: ON563414.3, MPXV_USA_2022_MA001; ON838178.1, isolate SI2022_S7) was produced by insect cells, followed by purification. This product contains ectodomain only (58-end), N-terminal Myc tag and C-terminal 6 hexa-histidine tag with amino acid sequence available upon request. The ectodomain includes cysteines for dimer formation. Amino acid sequence for A35R: lnqcmsankaaitdsavavaaassthrkvvssttqydhkescnglyyqgscyilhsdyksfedakancaaesstlpnksdvlttwlidyvedtwgsdgnpitkttsdyqdsdvsqevrkyfct. The monomeric form of this product is predicted to be a molecular mass of ~17 kDa.
This product has been run on SDS-PAGE with reduced condition. We also evaluated its binding to antibodies of anti-His, anti-Myc or clone RV10. The dimeric conformation was evaluated with SEC (Superose 6 column) with two peaks that we assigned one as a dimer fraction peak. The product is not a SEC fraction.
Applications:
Crystallization (Crys), ELISA, SDS-PAGE (SDS), Western Blotting (WB), Immunization or Antibody Sorting Probe and others
Source:
Insect cells
Biosafety Level:
BSL-1
Organism:
Monkeypox virus 2022 Strain
Size and Formulation:
100 or 500 μg in PBS, pH7.2, without preservatives.
Note: Not lyophilized formulation, so no lyophilized protectant reagents added.
Endotoxin:
Less than 1.0 EU per μg by the LAL method / rFC method.
Shipping or storage condition
Ship with dry ice. Recommend -80°C storage for long-term. Store at 4°C or −20 °C for short-term. Multiple freeze/Thaw cycles will reduce its activity. Aliquot is recommended.
Note:
For research use only.
