Zika virus E protein Domain III – His tag
Catalog Number:
X38F9
Description:
A recombinant form of domain III of envelope (E) protein from Zika virus, (2015_Brazil strain, GenBank: ALU33341) was produced by insect cells, followed by purification. This product contains C-terminal 6 hexa-histidine tag. Amino acid sequence is (vsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitan
pvitestenskmmleldppfgdsyivigvgekkithhwhrs). This product has been run on SEC (superose 6) and SDS-PAGE with reduced condition. We evaluated the binding of Flavivirus control mAb 4G2 (targets domain II of E protein), two published domain III-specific antibodies (ZV2 and ZV67) and one published Dengue cross-reactive antibody (EDE1-C8) in ELISAs, see results.
Applications:
Crystallization (Crys), ELISA, SDS-PAGE (SDS), Western Blotting (WB), Immunization or Antibody Sorting Probe, and others
Source:
Insect cells
Biosafety Level:
BSL-1
Organism:
Zika virus (2015_Brazil strain)
Size and Formulation:
100 or 500 μg in PBS, pH7.2, without preservatives.
Note: Not lyophilized formulation, so no lyophilized protectant reagents added.
Endotoxin:
Less than 1.0 EU per μg by the LAL method / rFC method.
Shipping or storage condition
Ship with dry ice. Recommend -80°C storage for long-term. Store at 4°C or −20 °C for short-term. Multiple freeze/Thaw cycles will reduce its activity. Aliquot is recommended.
Note:
For research use only.
