Monkeypox Virus Trimeric A29 protein (2022 Strain, His tag)
Catalog Number:
Y58C40
Description:
Monkeypox virus (MPXV) is a member of the Orthopoxvirus of the family Poxviridae. A27 protein is a target for viral neutralization and serves one of important components in vaccine. The native A27 is a homotrimeric extracellular protein that is attached to the viral membrane. Monkeypox virus A29 protein binds to cell surface heparan similar to Vaccinia virus strain Copenhagen A27 protein.
A recombinant form of monkeypox virus protein A29 (Genbank: ON563414.3, MPXV_USA_2022_MA001; ON838178.1, isolate SI2022_S7) was produced by insect cells, followed by purification. Amino acid sequence for A29: dgtlfpgdddlaipateffstkaaknpetkreaivkaygddneetlkqrltnlekkitnittkfeqiekcckrndevlfrlenhaetlraamislakkidvqtgrhpye. This product contains trimerization domain and C-terminal 6 hexa-histidine tag with sequence available upon request. The monomeric form of this product is predicted to be a molecular mass of ~18 kDa.
This product has been run on SDS-PAGE with reduced condition. We also evaluated its binding to anti-His antibody with a negative control. The trimeric conformation was evaluated with SEC (Superose 6 column) with two peaks that we assigned one as a trimer fraction peak. The product is not a SEC fraction.
Applications:
Crystallization (Crys), ELISA, SDS-PAGE (SDS), Western Blotting (WB), Immunization or Antibody Sorting Probe and others
Source:
Insect cells
Biosafety Level:
BSL-1
Organism:
Monkeypox virus 2022 Strain
Size and Formulation:
100 or 500 μg in PBS, pH7.2, without preservatives.
Note: Not lyophilized formulation, so no lyophilized protectant reagents added.
Endotoxin:
Less than 1.0 EU per μg by the LAL method / rFC method.
Shipping or storage condition
Ship with dry ice. Recommend -80°C storage for long-term. Store at 4°C or −20 °C for short-term. Multiple freeze/Thaw cycles will reduce its activity. Aliquot is recommended.
Note:
For research use only.












