SARS-CoV-2 nucleocapsid (N) protein – C-terminal domain (His and Myc tags)
Catalog Number:
M47G62
Description:
A recombinant form of nucleocapsid (N) protein C-terminal domain (CTD) (AA 255-364) from SARS-CoV-2 virus (Wuhan Strain, GenBank: NC_045512.2) was produced by insect cells, followed by purification. Amino acid sequence is SKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFP. This product contains N-terminal Myc tag and C-terminal 6 hexa-histidine tag. This product has been run on SDS-PAGE with reduced condition. We evaluated the binding of this protein to mAb clone RV20 (NTD-specific, Cat# W89S59), two tag-specific antibodies (anti-His or Myc) and one convalescent serum in ELISAs, see results.
Applications:
Crystallization (Crys), ELISA, SDS-PAGE (SDS), Western Blotting (WB), Immunization or Antibody Sorting Probe, and others
Source:
Insect cells
Biosafety Level:
BSL-1
Organism:
SARS-Related Coronavirus 2 (virus caused COVID-19)
Size and Formulation:
100 or 500 μg in PBS, pH7.2, without preservatives.
Note: Not lyophilized formulation, so no lyophilized protectant reagents added.
Endotoxin:
Less than 1.0 EU per μg by the LAL method / rFC method.
Shipping or storage condition
Ship with dry ice. Recommend -80°C storage for long-term. Store at 4°C or −20 °C for short-term. Multiple freeze/Thaw cycles will reduce its activity. Aliquot is recommended.
Note:
For research use only.







